Now reading Entry 089 / 102 Last revised Jan 22, 2026 52 sources 2 comparisons Methodology →
A specimen of the Hormonal drawer Drawer C · Hormonal

Tesamorelin

FDA Approved

An FDA-approved GHRH analog for reducing visceral fat in HIV-associated lipodystrophy. One of few GH-releasing peptides with regulatory approval and Phase 3 data.

Egrifta · Egrifta SV · Egrifta WR · TH9507

Research evidence
High

35 human studies

Preclinical
8%
Clinical
67%

Based on 52 cited sources

Historical editorial rating. No completed numerical assessment is established by this record. These scores are not formal GRADE assessments, measured treatment effects, or safety ratings.

Recorded primary indication:
HIV-associated lipodystrophy / visceral fat reduction
Compound / formulation, population, comparator, outcome and timepoint for the numeric assessment:
Not recorded in this score record
Evidence Score80/100
Well-evidenced
Research Depth86/100
Mechanism85/100
Plausibility89/100
Global Coverage57/100
Community Experience70/100

Community usage signal; not evidence of efficacy or safety. Provenance is not established by this score.

Effectiveness59/100

based on clinical studies · high confidence

Clinical-study effect summary; outcomes depend on population and endpoint. This score is not a probability of benefit or a safety rating.

Research Depth 86: systematic review of 10 RCTs incl. tesamorelin (Sivakumar 21265979, n=1511, all low RoB) sits at the SR-of-RCTs tier (1A 33); pivotal low-RoB Phase 3 RCTs (Falutz NEJM 18057338 n=412; pooled 20554713 n=806) plus that SR give 1B 22, total human N >1,000 (1C 13) with direct population/route/outcome match (1D 14); preclinical program is modest (only ~4 preclinical sources) so 1E 4. Mechanism 85: GHRH-R is a named, functionally-validated class target (2A 35) with the full Gas->cAMP/PKA->GH ->hepatic IGF-1 / adipocyte-lipolysis chain mapped (2B 26), human 1mg-vs-2mg in-vivo dose-response (2C 14, 2D 10). Plausibility 89: full mechanism->IGF-1 surrogate->CT-measured VAT clinical outcome each supported (3A 36), coherent with GH/adipose physiology (3B 24), multiple same-class GHRH agents replicate GH release (3C 18), claim mostly scoped but several downstream effects asserted (3D 11). Global Coverage 57: replication concentrated in the Grinspoon/MGH + Theratechnologies (Canada) cluster (4A 16), 2-3 core countries (4B 13), ~52 studies across lipodystrophy/NAFLD/cognition angles (4C 18), FDA + Health Canada approval (4D 10). Community Experience 70: broad-but-niche anti-aging/clinic use (5A 20), >7-yr track record since 2010 approval (5B 26), broadly consistent reports (5C 14), only minor injection-site/glucose-monitoring signals (5D 10). Effectiveness basis clinical (high): ~15-18% treatment-effect VAT reduction and liver-fat normalization (35% vs 4% to HFF<5%, 31611038) exceed MCID on a largely surrogate/imaging endpoint, superior to placebo with no head-to-head active comparator for the indication.

Scored June 2026 How we rate →
Evidence Level
high
FDA-approved as Egrifta for HIV-associated lipodystrophy.
FDA Approved
Identity
SCALE · 1:1 N-TERMINUS C-TERMINUS 44 AA · 5,135.87 Da
Also Known As
Egrifta • Egrifta SV • Egrifta WR • TH9507
Class
Modified GHRH Analog
Length
44 amino acids
Mol. weight
5,135.87 Da
Sequence
hex-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Molecular Structure
hex
Y
A
D
A
I
F
T
N
S
Y
R
K
V
L
G
Q
L
S
A
R
K
L
L
Q
D
I
M
S
R
Q
Q
G
E
S
N
Q
E
R
G
A
R
A
R
L
Hydrophobic
Polar
Positive
Negative

Tesamorelin is a modified version of GHRH (growth hormone-releasing hormone) with FDA approval for HIV-associated lipodystrophy. It works by stimulating your pituitary gland to release growth hormone in natural pulses, targeting visceral fat specifically.

How It Works (Simplified)

Tesamorelin works by mimicking the body’s natural GHRH signal to release growth hormone:

Pituitary Stimulation

Binds to GHRH receptors on pituitary somatotrophs, triggering natural GH release in physiologic pulses rather than continuous elevation.

Visceral Fat Targeting

GH preferentially mobilizes visceral fat due to higher receptor density and lipolytic sensitivity, sparing subcutaneous fat depots.

IGF-1 Restoration

Hepatic GH signaling increases IGF-1 production by ~81%, normalizing levels and supporting anabolic and metabolic functions.

Hepatic Effects

Reduces liver fat accumulation and improves hepatic oxidative phosphorylation, with evidence of fibrosis prevention in NAFLD.

Key Research: Falutz J et al. (2007) Phase 3 trial demonstrating 15.2% trunk fat reduction vs 5.0% increase with placebo. PMID:18057338

Important Limitations

  • Effects do not persist after discontinuation - VAT returns within weeks
  • Not approved for general weight loss, anti-aging, or athletic performance
  • May impair glucose tolerance - monitor blood glucose
  • Contraindicated with active malignancy due to GH/IGF-1 effects
  • Short half-life (26-38 min) requires daily administration

Research Tools

i. GHRH Receptor Signaling · GH Release
TesamorelinGHRH-R bindingGαs activationAdenylyl cyclase↑cAMPPKA activationGH gene transcription + vesicle exocytosisPulsatile GH release
ii. GH Metabolic Effects · Fat Reduction
GH releaseAdipocyte GH receptor bindingHSL activationTriglyceride hydrolysisPreferential visceral fat mobilizationVAT (15-27 cm²)
iii. Hepatic IGF-1 Axis · Anabolic Signaling
GHHepatic GH receptorJAK2/STAT5IGF-1 gene transcription↑IGF-1 (~81%)Lean mass preservation
Mechanism GHRH receptor agonism stimulating pulsatile growth hormone release from pituitary somatotrophs
Established 12 direct studies
Benefit shown to reduce visceral adipose tissue in HIV-associated lipodystrophy
Evidence Level
High
12 Human
2 Animal
1 In Vitro
Mechanism GH-mediated hepatic lipolysis and reduction of intrahepatic lipid accumulation
Supported 5 direct studies
Benefit appears to reduce hepatic fat in NAFLD/NASH
Evidence Level
Moderate
4 Human
Mechanism Restoration of physiologic IGF-1 levels and GH pulsatility improving metabolic signaling
Established 8 direct studies
Benefit shown to improve body composition with increased lean mass
Evidence Level
High
8 Human
1 Animal
Mechanism Improved hepatic oxidative phosphorylation and decreased inflammatory gene expression
Supported 3 direct studies
Benefit appears to prevent hepatic fibrosis progression
Evidence Level
Moderate
3 Human
Mechanism Confidence
Established
Supported
Emerging
Evidence Level
High
Moderate
Low
Very Low

Reported positives

  • Effective visceral fat reduction with clinical backing
  • FDA-approved status provides confidence in safety
  • Improved body composition without significant muscle loss
  • Cognitive benefits reported in aging populations

Reported negatives

  • Expensive even through anti-aging clinics
  • Injection site reactions common
  • Effects reverse after discontinuation
  • Insurance coverage limited to HIV lipodystrophy indication

“Gaining popularity in anti-aging clinics. FDA approval (Egrifta) gives it more legitimacy than research peptides.”

Self-reported, unverified accounts — not clinical evidence and no substitute for the cited research. Anecdotes are prone to selection bias and placebo effects.

NCT ID Title Peptide Phase Status Completion
NCT07481734
Tesamorelin for Reduction of Liver Fat in Adults With Fatty Liver Disease (Mock Study)
Metabolic Associated Steatotic Liver Disease, Nonalcoholic Steatohepatitis +1 more
Tesamorelin Phase 2 Recruiting Feb 2027
NCT06554717
Tesamorelin as an Adjunct to Exercise for Improving Physical Function in HIV
HIV-1-infection, Frailty +3 more
Tesamorelin Phase 2 Recruiting Jun 2028
NCT03375788
Growth Hormone Releasing Hormone Analog to Improve Nonalcoholic Fatty Liver Disease and Associated Cardiovascular Risk
Non-Alcoholic Fatty Liver Disease, Obesity +3 more
Tesamorelin Phase 2 Completed Jul 2024
NCT03150511
Tesamorelin to Improve Functional Outcomes After Peripheral Nerve Injury
Peripheral Nerve Injuries
Tesamorelin Phase 2 Recruiting Dec 2027
NCT03226821
Body Composition and Adipose Tissue in HIV
HIV Lipodystrophy Syndrome, Growth Hormone Deficiency +1 more
Tesamorelin Phase 4 Terminated Apr 2025
NCT02553603
The Effect of Growth Hormone Releasing Hormone on Cognitive Function in Individuals With Mild Cognitive Impairment
Mild Cognitive Impairment
Tesamorelin Phase 1 Completed Jan 2019
NCT02572323
Phase II Trial of Tesamorelin for Cognition in Aging HIV-Infected Persons
Mild Cognitive Impairment
Tesamorelin Phase 2 Completed Oct 2023
NCT02931474
Impact of GHRH on Sleep Promotion and Endocrine Regulation in Service Members Who Sustained a Traumatic Brain Injury and Have Current Insomnia
Sleep Disorder, Traumatic Brain Injury
Tesamorelin Phase 2 Withdrawn Mar 2017
NCT02196831
Tesamorelin Effects on Liver Fat and Histology in HIV
Human Immunodeficiency Virus (HIV), Nonalcoholic Fatty Liver Disease (NAFLD) +1 more
Tesamorelin Phase N/A Completed Jan 2019
NCT01632592
Abdominal Obesity, Cardiovascular Inflammation, and Effects of Growth Hormone Releasing Hormone Analogue
Abdominal Obesity
Tesamorelin Phase N/A Withdrawn Jan 2014
NCT01591902
Diabetic Retinopathy in HIV Subjects Treated With EGRIFTA®
Diabetic Retinopathy, HIV
Tesamorelin Phase 4 Terminated May 2018
NCT01388920
Efficacy and Safety Study of Tesamorelin in Chronic Obstructive Pulmonary Disease (COPD) Subjects With Muscle Wasting
Chronic Obstructive Pulmonary Disease (COPD)
Tesamorelin Phase 2 Terminated Dec 2011
NCT01263717
Effects of Growth Hormone Releasing Hormone in HIV
HIV, HIV Lipodystrophy
Tesamorelin Phase N/A Completed Feb 2014
NCT00795210
Effects of Short-term Growth Hormone in HIV-infected Patients
HIV Lipodystrophy
Tesamorelin Phase N/A Completed Nov 2012
NCT00850564
Effect of Short Term Growth Hormone Releasing Hormone in Healthy Men
Healthy Volunteers
Tesamorelin Phase N/A Completed Apr 2010
NCT00675506
Effectiveness of Growth Hormone Releasing Hormone in Reducing Abdominal Fat in People Who Are Obese
Abdominal Obesity, Growth Hormone Deficiency
Tesamorelin Phase 2 Completed Jan 2012
NCT02012556
Pharmacokinetic and Pharmacodynamic Study of TH9507, a Growth Hormone-Releasing Factor Analog, in HIV Positive Patients
HIV
Tesamorelin Phase 1 Completed Jul 2008
NCT00608023
TH9507 Extension Study in Patients With HIV-Associated Lipodystrophy
Lipodystrophy, HIV Infections
Tesamorelin Phase 3 Completed Oct 2008
NCT00257712
SMART: Somatotrophics, Memory, and Aging Research Trial
Aging, Mild Cognitive Impairment
Tesamorelin Phase 2 Completed Dec 2011
NCT00123253
TH9507 in Patients With HIV-Associated Lipodystrophy
HIV Infections, Lipodystrophy
Tesamorelin Phase 3 Completed Nov 2006
NCT01264497
Safety Study of TH9507 in Subjects With Stable, Type 2 Diabetes
Type 2 Diabetes
Tesamorelin Phase 2 Completed Nov 2002
NCT07481734 Recruiting

Tesamorelin for Reduction of Liver Fat in Adults With Fatty Liver Disease (Mock Study)

Tesamorelin Phase 2 Est. Feb 2027
NCT06554717 Recruiting

Tesamorelin as an Adjunct to Exercise for Improving Physical Function in HIV

Tesamorelin Phase 2 Est. Jun 2028
NCT03375788 Completed

Growth Hormone Releasing Hormone Analog to Improve Nonalcoholic Fatty Liver Disease and Associated Cardiovascular Risk

Tesamorelin Phase 2 Est. Jul 2024
NCT03150511 Recruiting

Tesamorelin to Improve Functional Outcomes After Peripheral Nerve Injury

Tesamorelin Phase 2 Est. Dec 2027
NCT03226821 Terminated

Body Composition and Adipose Tissue in HIV

Tesamorelin Phase 4 Est. Apr 2025
NCT02553603 Completed

The Effect of Growth Hormone Releasing Hormone on Cognitive Function in Individuals With Mild Cognitive Impairment

Tesamorelin Phase 1 Est. Jan 2019
NCT02572323 Completed

Phase II Trial of Tesamorelin for Cognition in Aging HIV-Infected Persons

Tesamorelin Phase 2 Est. Oct 2023
NCT02931474 Withdrawn

Impact of GHRH on Sleep Promotion and Endocrine Regulation in Service Members Who Sustained a Traumatic Brain Injury and Have Current Insomnia

Tesamorelin Phase 2 Est. Mar 2017
NCT02196831 Completed

Tesamorelin Effects on Liver Fat and Histology in HIV

Tesamorelin Phase N/A Est. Jan 2019
NCT01632592 Withdrawn

Abdominal Obesity, Cardiovascular Inflammation, and Effects of Growth Hormone Releasing Hormone Analogue

Tesamorelin Phase N/A Est. Jan 2014
NCT01591902 Terminated

Diabetic Retinopathy in HIV Subjects Treated With EGRIFTA®

Tesamorelin Phase 4 Est. May 2018
NCT01388920 Terminated

Efficacy and Safety Study of Tesamorelin in Chronic Obstructive Pulmonary Disease (COPD) Subjects With Muscle Wasting

Tesamorelin Phase 2 Est. Dec 2011
NCT01263717 Completed

Effects of Growth Hormone Releasing Hormone in HIV

Tesamorelin Phase N/A Est. Feb 2014
NCT00795210 Completed

Effects of Short-term Growth Hormone in HIV-infected Patients

Tesamorelin Phase N/A Est. Nov 2012
NCT00850564 Completed

Effect of Short Term Growth Hormone Releasing Hormone in Healthy Men

Tesamorelin Phase N/A Est. Apr 2010
NCT00675506 Completed

Effectiveness of Growth Hormone Releasing Hormone in Reducing Abdominal Fat in People Who Are Obese

Tesamorelin Phase 2 Est. Jan 2012
NCT02012556 Completed

Pharmacokinetic and Pharmacodynamic Study of TH9507, a Growth Hormone-Releasing Factor Analog, in HIV Positive Patients

Tesamorelin Phase 1 Est. Jul 2008
NCT00608023 Completed

TH9507 Extension Study in Patients With HIV-Associated Lipodystrophy

Tesamorelin Phase 3 Est. Oct 2008
NCT00257712 Completed

SMART: Somatotrophics, Memory, and Aging Research Trial

Tesamorelin Phase 2 Est. Dec 2011
NCT00123253 Completed

TH9507 in Patients With HIV-Associated Lipodystrophy

Tesamorelin Phase 3 Est. Nov 2006
NCT01264497 Completed

Safety Study of TH9507 in Subjects With Stable, Type 2 Diabetes

Tesamorelin Phase 2 Est. Nov 2002
Phase 01 1
Week 1-4

Based on clinical trials: IGF-1 levels increase by ~81% from baseline. Visceral fat reduction begins. Initial lipolytic effects on trunk fat measurable by imaging.

PMID:18057338
Phase 02 2
Week 4-12

Continued VAT reduction - Phase 3 trials showed 15.2% trunk fat reduction by week 12. Lean mass may increase (~1.4 kg). Body composition improvements become clinically apparent.

PMID:20554713
Phase 03 3
Week 12-26

Sustained effects with continued treatment. Mean VAT reduction of 27.7 cm² vs placebo in pooled Phase 3 analysis. Hepatic fat reduction observed in NAFLD studies.

PMID:20554713
Phase 04 4
Week 26+

Long-term extension data confirms durability with continued dosing. Effects reverse within weeks of discontinuation - chronic treatment required for maintained benefits.

PMID:25038357

Research-based observations

This timeline reflects observations from published clinical and preclinical studies. Individual responses may vary significantly. This is not a guarantee of effects or a dosing schedule. Consult qualified healthcare providers for personalized guidance.

Synergistic
Compatible
Caution
Avoid

GHRH+GHRP synergy is well-established. Tesamorelin (GHRH) and ipamorelin (GHRP) act through complementary pathways for enhanced GH release.

Classic GHRH+GHRP combination. Tesamorelin amplifies while GHRP-6 initiates GH pulse. Greater combined effect than either alone.

Synergistic GH release through complementary GHRH and GHRP pathways. No direct combination studies with tesamorelin specifically.

Tesamorelin increases GH which can affect glucose homeostasis. Monitor blood glucose carefully in diabetic patients.

GH elevation may impact glucose metabolism. Monitor carefully if combined with incretin-based therapies.

Both are GHRH analogs acting on the same receptor. No benefit to combining; may cause receptor desensitization.

Both are GHRH analogs with identical mechanism. Use one or the other, not both.

Research Note: Interaction data is based on published literature, mechanistic understanding, and theoretical considerations. Most peptide combinations lack direct clinical study. This information is for educational purposes only and does not constitute medical advice. Always consult qualified healthcare providers.

This dossier synthesizes available evidence from peer-reviewed literature, regulatory documents, and clinical trial registries. Evidence strength ratings follow a modified GRADE approach.

For complete methodology details, see our Methodology page.

Important Disclaimer

This dossier is for educational purposes only and does not constitute medical advice. Always consult a qualified healthcare provider before making health decisions.

Get Research Alerts

New dossiers and major study summaries delivered to your inbox. Evidence-graded, citation-backed research you can trust.

No spam. Unsubscribe anytime.

Compare Tesamorelin

Related Peptides

Hormonal

Follistatin

FST · FS-344 · FS-315 +1

An endogenous glycoprotein that inhibits myostatin and activin signaling, potentially allowing muscle growth beyond genetic limits. Gene therapy trials for muscular dystrophy show promise, but injectable peptide forms remain unapproved and understudied in humans.

See dossier
Hormonal

GHRP-2

Growth Hormone Releasing Peptide-2 · Pralmorelin · KP-102

A synthetic hexapeptide GH secretagogue with the strongest GH-releasing potency in its class. More potent than GHRP-6 with different side effect profile: less appetite stimulation but greater cortisol and prolactin elevation. Approved in Japan as Pralmorelin for GH deficiency diagnosis. Extensively studied in human pharmacology with robust clinical data.

See dossier
Hormonal

GHRP-6

Growth Hormone Releasing Peptide-6 · SKF-110679 · Growth Hormone-Releasing Hexapeptide

A first-generation growth hormone secretagogue that stimulates GH release through the ghrelin receptor. Less selective than newer alternatives with effects on cortisol and prolactin. Historically significant as the peptide that led to ghrelin discovery. Cuban CIGB leads global cytoprotective research. Not approved for any indication.

See dossier
Hormonal

Human Chorionic Gonadotropin (hCG)

hCG · Choriogonadotropin · Pregnyl +5

A glycoprotein hormone FDA-approved for ovulation induction, cryptorchidism, and hypogonadotropic hypogonadism. Functions as an LH receptor agonist with over 50 years of clinical use in reproductive medicine. Gold standard trigger for assisted reproductive technology.

See dossier
Hormonal

Hexarelin

Examorelin · HEX · Growth Hormone Releasing Hexapeptide +2

The most potent synthetic GHRP (Growth Hormone Releasing Peptide), a hexapeptide that strongly stimulates GH release via the ghrelin receptor. Notable for cardioprotective effects independent of GH release. Development discontinued due to rapid desensitization with repeated dosing. Italian research leads global investigation.

See dossier
Hormonal

HMG

Human Menopausal Gonadotropin · Menotropins · hMG +4

A urinary-derived glycoprotein hormone preparation containing both FSH and LH in approximately 1:1 ratio, FDA-approved for female infertility (ovulation induction, ART) and male hypogonadotropic hypogonadism. First used clinically in 1961 by Bruno Lunenfeld, HMG enabled the birth of the first American IVF baby in 1981 and remains a cornerstone of fertility medicine with over 60 years of clinical experience. Highly purified preparations (HP-hMG) demonstrate comparable or slightly superior live birth rates compared to recombinant FSH in IVF.

See dossier
Safety profile Tesamorelin: adverse events, contraindications and monitoring

Compared With

5 comparisons

Conditions Studied

6 entries

Related Content