Now reading Entry 077 / 102 Last revised Jan 22, 2026 40 sources 2 comparisons Methodology →
A specimen of the Hormonal drawer Drawer C · Hormonal

Sermorelin

Research Only

A GHRH analog that was FDA-approved for pediatric GH deficiency. Now discontinued commercially but established safety and efficacy profile exists.

Geref · GRF 1-29 · GHRH(1-29)NH2

Research evidence
Moderate

32 human studies

Preclinical
20%
Clinical
80%

Based on 40 cited sources

Evidence Score79/100
Emerging / moderate
Research Depth71/100
Mechanism94/100
Plausibility87/100
Global Coverage70/100
Community Experience74/100
Effectiveness52/100

clinically demonstrated · moderate confidence

Demonstrated effect magnitude — not a recommendation or safety claim.

Research Depth 71: ≥2 independent RCTs (1A 30) — Geref pivotal open-label N=110 (8772599), Baker double-blind placebo-controlled N=152 (22869065), Friedman MRS RCT (23689947), Khorram RCT (9141536), Corpas crossover (1379256) — but no sermorelin-specific meta-analysis; best study low-moderate RoB with no high-confidence SR (1B 15); aggregate human N in the 300–1,000 band (1C 8); direct population/route/outcome (1D 12); modest preclinical base (1E 6). Mechanism 94: GHRH-R named target with binding + functional confirmation, and hypophysectomy abolishes the REM-promoting effect (2A 40, Obál 8779943); full GHRH-R→Gs→cAMP→PKA→GH pathway (2B 28); in-vivo dose-response across human and rat models (2C 16, 2D 10). Plausibility 87: full mechanism→IGF-1 surrogate→growth-velocity clinical chain for the GHD indication (3A 34), fully coherent with somatotropic-axis physiology (3B 24), multiple same-class GHRH analogs reproduce the effect (3C 18), moderately broad multi-system claims kept mechanism-consistent (3D 11). Global Coverage 70: replicated across independent groups/countries — Virginia Geref multicenter, Washington (Baker/Friedman), UCSD (Khorram), Max Planck (Steiger 1361964), Hungary (Obál) (4A 27, 4B 15); ~32 human studies (4C 18); one national regulator, former FDA Geref approval (4D 10). Community Experience 74: one of the earliest anti-aging-clinic peptides with >7-year track record, broadly consistent sleep/body-composition themes, no recurring serious adverse signal (5A 22 / 5B 26 / 5C 14 / 5D 12). Effectiveness basis clinical (moderate): pivotal GHD trial raised height velocity 4.1→8.0 cm/yr with 74% responders (large on the surrogate), hard patient-relevant outcome, but generally superior to placebo rather than to direct rhGH standard of care, and adult anti-aging/cognition effects are modest (E1 18 / E2 12 / E3 12 / E4 10).

Scored June 2026 How we rate →
~
Evidence Level
moderate
Not approved for human use by any regulatory agency
Limited human clinical trial data
Consult a healthcare provider before use
Not FDA Approved WADA Prohibited
Identity
SCALE · 1:1 N-TERMINUS C-TERMINUS 29 AA · 3,357.93 Da
Also Known As
Geref • GRF 1-29 • GHRH(1-29)NH2
Class
Nonapeptide analog of GHRH
Length
29 amino acids
Mol. weight
3,357.93 Da
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRNH2
Molecular Structure
Y
A
D
A
I
F
T
N
S
Y
R
K
V
L
G
Q
L
S
A
R
K
L
L
Q
D
I
M
S
R
Hydrophobic
Polar
Positive
Negative

Sermorelin is the biologically active 1-29 amino acid fragment of endogenous GHRH (Growth Hormone-Releasing Hormone). It stimulates the pituitary gland to release growth hormone through receptor-mediated signaling, preserving natural feedback mechanisms.

How It Works (Simplified)

Sermorelin acts as a “release signal” that tells your pituitary gland to produce growth hormone:

Binds to GHRH receptors on pituitary somatotroph cells, triggering the cAMP/PKA signaling cascade that initiates GH synthesis and release.

Pulsatile Release

Stimulates natural pulsatile GH secretion rather than constant elevation, preserving your body’s feedback systems and circadian rhythm.

Sleep Enhancement

Acts on CNS GHRH receptors to promote slow-wave sleep independently of peripheral GH effects, enhancing restorative deep sleep phases.

IGF-1 Elevation

Increased GH stimulates hepatic IGF-1 production, mediating anabolic effects on lean tissue and metabolic improvements.

Key Research: Thorner M et al. (USA, 1996) demonstrated 74% growth acceleration in GH-deficient children in the pivotal Geref International Study. PMID:8772599

Important Limitations

  • Requires functional pituitary gland to produce effects
  • Short half-life (10-20 minutes) necessitates daily administration
  • Effects may diminish in severe pituitary damage or destruction
  • Was FDA-approved but discontinued in 2008 for business reasons (not safety concerns)
i. GHRH-R/cAMP/PKA Pathway · Primary GH Release
SermorelinGHRH-R (GPCR)Gs proteinAdenylyl CyclaseATPcAMPPKA activationGH gene transcription + vesicle exocytosis
ii. Secondary Pathway · PLC/IP3/DAG
GHRH-R activationPLCIP3 + DAGIntracellular Ca²⁺ releasePre-synthesized GH release
Mechanism GHRH receptor activation triggering cAMP/PKA signaling cascade in pituitary somatotrophs
Established 12 direct studies
Benefit shown to stimulate endogenous growth hormone release
Evidence Level
High
10 Human
4 Animal
3 In Vitro
Mechanism Enhancement of slow-wave sleep through CNS GHRH receptor activation independent of peripheral GH
Supported 6 direct studies
Benefit appears to improve sleep quality and slow-wave sleep duration
Evidence Level
Moderate
5 Human
3 Animal
Mechanism Increased brain GABA levels through GHRH-mediated neuroendocrine pathways
Supported 3 direct studies
Benefit may enhance cognitive function including working memory and processing speed
Evidence Level
Moderate
3 Human
1 Animal
Mechanism Restoration of physiologic IGF-1 levels promoting anabolic effects on lean tissue
Established 8 direct studies
Benefit shown to improve body composition by increasing lean mass and reducing fat mass
Evidence Level
Moderate
6 Human
2 Animal
Mechanism Confidence
Established
Supported
Emerging
Evidence Level
High
Moderate
Low
Very Low

Reported positives

  • Improved sleep quality frequently cited as primary benefit
  • Gradual body composition improvements reported
  • Well-tolerated with fewer side effects than direct GH
  • Available through anti-aging clinics with medical supervision

Reported negatives

  • Effects subtle and require months of consistent use
  • Injection site reactions and irritation
  • Fasting requirements for optimal timing
  • Efficacy decreases with age as GH receptors decline

“One of the earliest peptides prescribed in anti-aging clinics. Community views it as a milder, safer GH alternative.”

Self-reported, unverified accounts — not clinical evidence and no substitute for the cited research. Anecdotes are prone to selection bias and placebo effects.

Phase 01 1
First Dose

GH release begins within 15-30 minutes of subcutaneous injection. Peak GH typically occurs 30-60 minutes post-injection. Sermorelin produces a physiological pulsatile GH response.

Phase 02 2
Week 1-4

Based on clinical trial data: Daily administration establishes regular GH pulsatility. IGF-1 levels begin to rise. Some patients report improved sleep quality early in treatment.

Phase 03 3
Week 4-12

Clinical studies in GH-deficient children showed growth velocity improvements over 6-12 months. In adult studies, IGF-1 levels approached normal ranges with continued use.

Phase 04 4
Month 3-6

Growth velocity improvements documented in pediatric GHD trials. Body composition changes (increased lean mass, reduced fat) may become apparent with continued use.

Phase 05 5
Month 6+

Long-term pediatric studies showed sustained growth improvements. Sermorelin was FDA-approved for pediatric GHD before discontinuation in 2008 due to manufacturing (not safety) issues.

Research-based observations

This timeline reflects observations from published clinical and preclinical studies. Individual responses may vary significantly. This is not a guarantee of effects or a dosing schedule. Consult qualified healthcare providers for personalized guidance.

Good Signs (7 indicators)
White to off-white lyophilized powder
Complete dissolution in bacteriostatic water
Clear, colorless solution after reconstitution
Certificate of analysis with >97% purity
HPLC verification of identity
Compounding pharmacy is PCAB or similar accredited
Obtained through legitimate medical prescription
Warning Signs (5 indicators)
Slight off-white coloration
Slower dissolution than expected
Compounding pharmacy not accredited
No third-party testing verification
Limited documentation of source
Bad Signs (7 indicators)
Yellow or brown discoloration
Visible particles in reconstituted solution
Cloudy appearance after mixing
No certificate of analysis
Unusual odor
Vial seal compromised
Source cannot be verified
Positive quality indicator
Requires evaluation
Potential quality issue

For Research Evaluation Only

These quality indicators are general guidelines based on typical peptide characteristics. Professional laboratory testing (HPLC, mass spectrometry) provides definitive quality verification. This checklist is for initial visual evaluation only.

Synergistic
Compatible
Caution
Avoid

GHRH+GHRP synergy well-documented in literature. Sermorelin (GHRH) combined with ipamorelin (GHRP) produces greater GH release than either alone through complementary receptor pathways.

Classic synergistic combination used in research. GHRH amplifies GH pulse while GHRP initiates release.

Complementary mechanisms through GHRH and ghrelin receptor pathways produce synergistic GH secretion.

MK-677 acts on ghrelin receptor while sermorelin acts on GHRH receptor. Complementary pathways may enhance GH release.

GH secretagogues may affect glucose metabolism. Monitor in diabetic patients.

Both are GHRH analogs acting on the same receptor (GHRH-R). Combination provides no benefit and may cause receptor desensitization.

Both are GHRH analogs with identical mechanism of action. Use one or the other.

Research Note: Interaction data is based on published literature, mechanistic understanding, and theoretical considerations. Most peptide combinations lack direct clinical study. This information is for educational purposes only and does not constitute medical advice. Always consult qualified healthcare providers.

This dossier synthesizes available evidence from peer-reviewed literature, regulatory documents, and clinical trial registries. Evidence strength ratings follow a modified GRADE approach.

For complete methodology details, see our Methodology page.

Important Disclaimer

This dossier is for educational purposes only and does not constitute medical advice. Always consult a qualified healthcare provider before making health decisions.

Get Research Alerts

New dossiers and major study summaries delivered to your inbox. Evidence-graded, citation-backed research you can trust.

No spam. Unsubscribe anytime.

Compare Sermorelin

Related Peptides

Hormonal

Follistatin

FST · FS-344 · FS-315 +1

An endogenous glycoprotein that inhibits myostatin and activin signaling, potentially allowing muscle growth beyond genetic limits. Gene therapy trials for muscular dystrophy show promise, but injectable peptide forms remain unapproved and understudied in humans.

See dossier
Hormonal

GHRP-2

Growth Hormone Releasing Peptide-2 · Pralmorelin · KP-102

A synthetic hexapeptide GH secretagogue with the strongest GH-releasing potency in its class. More potent than GHRP-6 with different side effect profile: less appetite stimulation but greater cortisol and prolactin elevation. Approved in Japan as Pralmorelin for GH deficiency diagnosis. Extensively studied in human pharmacology with robust clinical data.

See dossier
Hormonal

GHRP-6

Growth Hormone Releasing Peptide-6 · SKF-110679 · Growth Hormone-Releasing Hexapeptide

A first-generation growth hormone secretagogue that stimulates GH release through the ghrelin receptor. Less selective than newer alternatives with effects on cortisol and prolactin. Historically significant as the peptide that led to ghrelin discovery. Cuban CIGB leads global cytoprotective research. Not approved for any indication.

See dossier
Hormonal

Human Chorionic Gonadotropin (hCG)

hCG · Choriogonadotropin · Pregnyl +5

A glycoprotein hormone FDA-approved for ovulation induction, cryptorchidism, and hypogonadotropic hypogonadism. Functions as an LH receptor agonist with over 50 years of clinical use in reproductive medicine. Gold standard trigger for assisted reproductive technology.

See dossier
Hormonal

Hexarelin

Examorelin · HEX · Growth Hormone Releasing Hexapeptide +2

The most potent synthetic GHRP (Growth Hormone Releasing Peptide), a hexapeptide that strongly stimulates GH release via the ghrelin receptor. Notable for cardioprotective effects independent of GH release. Development discontinued due to rapid desensitization with repeated dosing. Italian research leads global investigation.

See dossier
Hormonal

HMG

Human Menopausal Gonadotropin · Menotropins · hMG +4

A urinary-derived glycoprotein hormone preparation containing both FSH and LH in approximately 1:1 ratio, FDA-approved for female infertility (ovulation induction, ART) and male hypogonadotropic hypogonadism. First used clinically in 1961 by Bruno Lunenfeld, HMG enabled the birth of the first American IVF baby in 1981 and remains a cornerstone of fertility medicine with over 60 years of clinical experience. Highly purified preparations (HP-hMG) demonstrate comparable or slightly superior live birth rates compared to recombinant FSH in IVF.

See dossier

Related Content