Now reading Entry 027 / 102 Last revised Jan 22, 2026 38 sources Methodology →
A specimen of the Hormonal drawer Drawer C · Hormonal

Follistatin

Research Only

An endogenous glycoprotein that inhibits myostatin and activin signaling, potentially allowing muscle growth beyond genetic limits. Gene therapy trials for muscular dystrophy show promise, but injectable peptide forms remain unapproved and understudied in humans.

FST · FS-344 · FS-315 · Activin-Binding Protein

Research evidence
Moderate

8 human studies

Preclinical
79%
Clinical
21%

Based on 38 cited sources

Evidence Score60/100
Emerging / moderate
Research Depth35/100
Mechanism91/100
Plausibility82/100
Global Coverage54/100
Community Experience48/100
Effectiveness52/100

clinically demonstrated · very-low confidence

Demonstrated effect magnitude — not a recommendation or safety claim.

Research Depth 35: best human evidence is two small open-label AAV1-FS344 gene-therapy trials (Mendell 2015 BMD n=6 25322757; Mendell 2017 sIBM n=6 vs 8 matched untreated 28279643) — single-uncontrolled-study tier (1A 15), high risk of bias (1B 5), total human N<50 (1C 2), indirect to the marketed injectable-peptide route (1D 6), plus a substantial multi-model preclinical program in mice and macaques (1E 7). Mechanism 91: myostatin/activin target with measured binding (activin Kd ~45 pM), crystal structure showing receptor-site occlusion (Thompson 2005 16198295) and genetic confirmation — follistatin effect in myostatin-null background (Lee 2007 17726519) and IGF-IR dominant-negative abolishing ~63% of hypertrophy (Kalista 2011 22087027) (2A 40); near-full target-to-effect pathway incl. IGF-1R/Akt/mTOR (2B 26); in-vivo dose-response across AAV-dose cohorts and primates (2C 16, 2D 9). Plausibility 82: mechanism->surrogate(muscle mass)->clinical(6MWT) chain supported for gene therapy, coherent with cross-species myostatin-null biology, class support from myostatin/activin inhibitors (sotatercept), with the peptide-delivery link unproven keeping it below full marks. Global Coverage 54: human trials concentrated in one Nationwide Children's group, preclinical independently replicated (JHU, Belgium/Finland, OSU) across 4-6 countries; AAV-FS344 carries FDA clinical-trial registration (4D 5). Community Experience 48: niche but persistent bodybuilding interest in black-market FS-344/FS-315, mixed/inconsistent reports and serious product authenticity issues (WADA found only 9/17 products contained follistatin). Effectiveness basis clinical (very-low): gene-therapy 6MWT gains (+58-125 m BMD; +56 vs -25.8 m/year sIBM) exceed the ~30 m MCID on a hard functional outcome, but from tiny uncontrolled trials in a delivery modality distinct from the marketed injectable peptide.

Scored June 2026 How we rate →
~
Evidence Level
moderate
Not approved for human use by any regulatory agency
Limited human clinical trial data
Consult a healthcare provider before use
Not FDA Approved WADA Prohibited
Identity
SCALE · 1:1 N-TERMINUS C-TERMINUS 344 AA · 36-38 kDa (FST-315); 38-44 kDa (FST-344 with glycosylation)
Also Known As
FST • FS-344 • FS-315 • Activin-Binding Protein
Class
Cysteine-rich glycoprotein
Length
344 amino acids
Mol. weight
36-38 kDa (FST-315); 38-44 kDa (FST-344 with glycosylation)
Sequence
MVRARHQPGGNCRFLRAQRCISLCHCVGLNLTLPTDGRCLCVCAPFVPGASCREVPRPSQRSASRDSSFSTSSEKNVVCC
Molecular Structure
M
V
R
A
R
H
Q
P
G
G
N
C
R
F
L
Hydrophobic
Polar
Positive
Negative

Follistatin’s mechanisms are well-characterized through structural biology and gene therapy trials, though injectable peptide effects in humans remain unvalidated.

How It Works (Simplified)

Follistatin acts as a “molecular sponge” that neutralizes muscle-limiting proteins:

Myostatin Blockade

Binds and sequesters myostatin (GDF-8), the body’s primary muscle growth limiter, preventing it from signaling muscles to stop growing.

Activin Neutralization

Binds activin A with extremely high affinity (Kd ~45 pM), reducing catabolic signaling that promotes muscle wasting.

Receptor Blocking

Two follistatin molecules encircle each ligand, physically blocking access to ActRIIA/ActRIIB receptors on muscle cells.

IGF-1R Potentiation

Hypertrophic effects require functional IGF-1 receptor signaling; follistatin removes inhibition rather than directly stimulating growth.

Key Research: Crystal structures PMID:16198295 and gene therapy trials PMID:25322757 confirm mechanism.

Important Limitations

  • All human efficacy data comes from gene therapy (AAV delivery), not injectable peptides
  • Native follistatin has very short half-life (~4 min initial, ~130 min terminal) limiting systemic effects
  • Gene therapy produces sustained local expression; peptide injection kinetics are entirely different
  • Black market FS-344/FS-315 products have significant quality issues (WADA found only 9/17 contained follistatin)
  • Translation from gene therapy success to injectable peptide effects is not scientifically supported
i. Myostatin/Activin Sequestration Pathway · Primary mechanism
Follistatin (2 molecules)Encircle myostatin/activin dimerBlock receptor sitesReduced Smad2/3 phosphorylationMuscle hypertrophy
ii. IGF-1R Requirement · Necessary for effect
FollistatinMyostatin inhibitionRequires IGF-1R/Akt/mTOR intactFull hypertrophic response

Net effect.IGF-1R inhibition reduces the effect by ~63%.

Mechanism Sequestration of myostatin (GDF-8), preventing receptor binding and removing muscle growth inhibition
Established 12 direct studies
Benefit shown to increase muscle mass and strength
Evidence Level
Moderate
3 Human
15 Animal
8 In Vitro
Mechanism Inhibition of activin A signaling through high-affinity binding (Kd ~45 pM)
Established 8 direct studies
Benefit appears to reduce muscle catabolism and wasting
Evidence Level
Moderate
2 Human
10 Animal
5 In Vitro
Mechanism IGF-1 receptor pathway potentiation required for hypertrophic response
Supported 4 direct studies
Benefit may enhance muscle growth signaling cascades
Evidence Level
Low
6 Animal
3 In Vitro
Mechanism Improvement of neuromuscular junction innervation and transmission in aged tissue
Emerging 2 direct studies
Benefit suggested to improve muscle function in aging
Evidence Level
Low
3 Animal
1 In Vitro
Mechanism Confidence
Established
Supported
Emerging
Evidence Level
High
Moderate
Low
Very Low

Reported positives

  • Myostatin inhibition concept appeals to muscle building community
  • Improved recovery and muscle growth reported by some
  • Theoretical muscle preservation benefits during cutting
  • Growing research interest in muscle wasting applications

Reported negatives

  • Very expensive with minimal evidence of effectiveness
  • Extremely limited human data for injectable use
  • Product quality and authenticity difficult to verify
  • Potential concerns about unregulated cell proliferation

“Niche interest in bodybuilding. Concept of myostatin inhibition generates discussion but evidence is thin.”

Self-reported, unverified accounts — not clinical evidence and no substitute for the cited research. Anecdotes are prone to selection bias and placebo effects.

Phase 01 1
Acute

Native follistatin has very short half-life (~4 min initial, ~130 min terminal). Injectable peptide effects would be transient. Gene therapy produces sustained local expression over months to years.

PMID:25322757
Phase 02 2
Gene therapy timeline

In AAV gene therapy studies, muscle improvements developed over months and were durable in primate studies. This timeline is specific to gene therapy, not peptide injection.

PMID:20368179
Phase 03 3
Long-term

Long-term safety of sustained myostatin inhibition is uncertain. Concerns include effects on cardiac muscle, tendons, and other tissues. Gene therapy trials continue to monitor safety.

Research-based observations

This timeline reflects observations from published clinical and preclinical studies. Individual responses may vary significantly. This is not a guarantee of effects or a dosing schedule. Consult qualified healthcare providers for personalized guidance.

Good Signs (4 indicators)
Specification of variant (FS-344 vs FS-315)
Certificate of analysis with purity verification
HPLC and mass spec confirmation
Proper lyophilization and cold chain
Warning Signs (4 indicators)
No specification of follistatin variant
No third-party testing
Unclear source
WADA analysis found only 9/17 products contained actual follistatin
Bad Signs (5 indicators)
Discolored product
No certificate of analysis
Sold with efficacy claims despite lack of human peptide injection data
Cannot verify actual follistatin content
Claims of gene therapy-like results from peptide injection
Positive quality indicator
Requires evaluation
Potential quality issue

For Research Evaluation Only

These quality indicators are general guidelines based on typical peptide characteristics. Professional laboratory testing (HPLC, mass spectrometry) provides definitive quality verification. This checklist is for initial visual evaluation only.

Synergistic
Compatible
Caution
Avoid

Follistatin's hypertrophic effects require intact IGF-1R/Akt/mTOR pathway. IGF-1 LR3 activates this pathway directly. Combined use may amplify muscle growth but also compounds unknown risks.

Compatible

HGH increases IGF-1, which is required for follistatin's full effect. Theoretical synergy, but combined safety not established.

Different regenerative targets - follistatin for muscle growth via myostatin inhibition, BPC-157 for tissue healing. No known interactions.

Different mechanisms - TB-500 for tissue repair via actin regulation, follistatin for muscle growth via myostatin/activin sequestration.

Avoid

Follistatin already inhibits myostatin. Adding other myostatin inhibitors is redundant and may cause unpredictable effects on the activin/myostatin/follistatin balance.

Research Note: Interaction data is based on published literature, mechanistic understanding, and theoretical considerations. Most peptide combinations lack direct clinical study. This information is for educational purposes only and does not constitute medical advice. Always consult qualified healthcare providers.

This dossier synthesizes available evidence from peer-reviewed literature, regulatory documents, and clinical trial registries. Evidence strength ratings follow a modified GRADE approach.

For complete methodology details, see our Methodology page.

Important Disclaimer

This dossier is for educational purposes only and does not constitute medical advice. Always consult a qualified healthcare provider before making health decisions.

Get Research Alerts

New dossiers and major study summaries delivered to your inbox. Evidence-graded, citation-backed research you can trust.

No spam. Unsubscribe anytime.

Compare Follistatin

Related Peptides

Hormonal

CJC-1295

DAC:GRF · Modified GRF 1-29 · Tetrasubstituted GRF

A synthetic analog of growth hormone-releasing hormone (GHRH) with extended half-life. Limited clinical development; not approved for any indication.

See dossier
Hormonal

GHRP-2

Growth Hormone Releasing Peptide-2 · Pralmorelin · KP-102

A synthetic hexapeptide GH secretagogue with the strongest GH-releasing potency in its class. More potent than GHRP-6 with different side effect profile: less appetite stimulation but greater cortisol and prolactin elevation. Approved in Japan as Pralmorelin for GH deficiency diagnosis. Extensively studied in human pharmacology with robust clinical data.

See dossier
Hormonal

GHRP-6

Growth Hormone Releasing Peptide-6 · SKF-110679 · Growth Hormone-Releasing Hexapeptide

A first-generation growth hormone secretagogue that stimulates GH release through the ghrelin receptor. Less selective than newer alternatives with effects on cortisol and prolactin. Historically significant as the peptide that led to ghrelin discovery. Cuban CIGB leads global cytoprotective research. Not approved for any indication.

See dossier
Hormonal

Human Chorionic Gonadotropin (hCG)

hCG · Choriogonadotropin · Pregnyl +5

A glycoprotein hormone FDA-approved for ovulation induction, cryptorchidism, and hypogonadotropic hypogonadism. Functions as an LH receptor agonist with over 50 years of clinical use in reproductive medicine. Gold standard trigger for assisted reproductive technology.

See dossier
Hormonal

Hexarelin

Examorelin · HEX · Growth Hormone Releasing Hexapeptide +2

The most potent synthetic GHRP (Growth Hormone Releasing Peptide), a hexapeptide that strongly stimulates GH release via the ghrelin receptor. Notable for cardioprotective effects independent of GH release. Development discontinued due to rapid desensitization with repeated dosing. Italian research leads global investigation.

See dossier
Hormonal

HMG

Human Menopausal Gonadotropin · Menotropins · hMG +4

A urinary-derived glycoprotein hormone preparation containing both FSH and LH in approximately 1:1 ratio, FDA-approved for female infertility (ovulation induction, ART) and male hypogonadotropic hypogonadism. First used clinically in 1961 by Bruno Lunenfeld, HMG enabled the birth of the first American IVF baby in 1981 and remains a cornerstone of fertility medicine with over 60 years of clinical experience. Highly purified preparations (HP-hMG) demonstrate comparable or slightly superior live birth rates compared to recombinant FSH in IVF.

See dossier

Compared With

1 comparison

Conditions Studied

4 entries

Related Content