Back to Library
ID: SEMAGLUTIDE STATUS: ACTIVE

Semaglutide

FDA Approved

Also known as: Ozempic, Wegovy, Rybelsus, NN9535

A GLP-1 receptor agonist FDA-approved for type 2 diabetes, obesity, cardiovascular risk reduction, and MASH. Among the most extensively studied peptides with robust Phase 3 data demonstrating significant metabolic, cardiovascular, renal, and hepatic benefits.

Metabolic High Evidence 95 Sources

Research Statistics

Total Sources
95
Human Studies
78
Preclinical
17
Evidence Rating High Evidence
Research Depth 5/5
Global Coverage 5/5
Mechanism Plausibility 5/5
Community Experience 5/5
Overall Score
5 /5

Anchor peptide: top-tier evidence. Multiple global Phase 3 RCT programs (SUSTAIN, STEP, SELECT, FLOW, ESSENCE) with tens of thousands of participants across 40+ countries. GLP-1 receptor agonism is a textbook-level established mechanism. FDA-approved for T2D, obesity, CV risk reduction, and kidney disease.

Last reviewed April 2026 How we rate →
Evidence Level
high
Not approved for human use by any regulatory agency
Limited human clinical trial data
Consult a healthcare provider before use
Not FDA Approved WADA Prohibited

Research Dossier

01 / 7

Overview

What is Semaglutide and what does the research say?

Identity
Also Known As
Ozempic • Wegovy • Rybelsus • NN9535
Type
Modified GLP-1 Analog
Length
31 amino acids
Weight
4,113.58 Da
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Molecular Structure
H
Aib
E
G
T
F
T
S
D
V
S
S
Y
L
E
G
Q
A
A
K
E
F
I
A
W
L
V
K
G
R
K*
Hydrophobic
Polar
Positive
Negative

Mechanism of Action

Semaglutide is a selective GLP-1 receptor agonist with extensive Phase 3 clinical trial data supporting its mechanisms in humans.

How It Works (Simplified)

Semaglutide mimics GLP-1, a natural hormone released after eating, producing multiple therapeutic effects:

Binds to GLP-1 receptors on pancreatic beta cells, triggering glucose-dependent insulin release. Only works when blood sugar is elevated, minimizing hypoglycemia risk.

Acts on hypothalamic hunger centers, activating satiety pathways (POMC/CART) while suppressing hunger signals (NPY/AgRP). Reduces caloric intake by 20-35%.

3
Glucose Regulation

Suppresses inappropriate glucagon secretion from alpha cells and enhances insulin sensitivity, improving overall glycemic control in type 2 diabetes.

Slows stomach emptying, prolonging satiety after meals and reducing postprandial glucose spikes. Contributes to both weight loss and glycemic benefits.

Scientific Pathways

GLP-1R Signaling Cascade (Primary Mechanism)

Semaglutide binds GLP-1R (Class B1 GPCR)
    |
    v
G-alpha-s activation --> Adenylyl cyclase --> cAMP increase
    |
    v
Protein Kinase A (PKA) activation
    |
    +---> Beta cells: Glucose-dependent insulin exocytosis
    +---> Alpha cells: Glucagon suppression
    +---> Hypothalamus: POMC/CART activation, NPY/AgRP inhibition
    +---> GI tract: Delayed gastric emptying

Key Research: SUSTAIN and STEP Phase 3 programs demonstrated these mechanisms translate to clinically meaningful outcomes in over 20,000 patients. PMID:33567185

2025-2026 Developments

Oral Wegovy Approval: The FDA approved oral semaglutide 25mg (Wegovy) in December 2025, marking the first oral GLP-1 formulation approved for chronic weight management at a launch price of approximately $149/month.

MASH Indication: Semaglutide received FDA approval for metabolic dysfunction-associated steatohepatitis (MASH), expanding its therapeutic indications beyond diabetes and obesity.

Safety Signal — Acute Kidney Injury: Post-marketing pharmacovigilance data from the FDA Adverse Event Reporting System (FAERS) identified a signal for acute kidney injury (PMID: 40285721), primarily associated with dehydration from GI adverse events. Monitoring guidance has been updated accordingly.

Patent Landscape: The core semaglutide compound patent expired in March 2026 across several major markets including India, Canada, China, Brazil, and Turkey, with 40+ biosimilar applications filed in India alone.

Important Limitations

  • Common GI side effects: Nausea (30-45%), vomiting, diarrhea, and constipation, especially during dose titration
  • Boxed warning: Thyroid C-cell tumors observed in rodents; contraindicated in personal/family history of medullary thyroid carcinoma (MTC) or MEN2
  • Gallbladder disease: Increased risk (~2.5%) associated with rapid weight loss
  • Pancreatitis: Rare (~0.3%) but requires discontinuation if suspected
  • Pregnancy: Contraindicated; discontinue at least 2 months before planned conception
  • Weight regain: Approximately 2/3 of lost weight returns within 1 year of discontinuation (STEP 4)
  • Muscle mass: ~30% of weight lost is lean mass; resistance training recommended

Evidence-Chained Benefits

Evidence-Chained Benefits

Research findings linked to mechanisms and clinical outcomes

Mechanism GLP-1R activation triggering glucose-dependent insulin secretion
Established 50 direct studies
Benefit shown to significantly reduce HbA1c in type 2 diabetes
Evidence Level
High
25 Human
10 Animal
5 In Vitro
Mechanism Central appetite suppression via hypothalamic POMC/CART activation
Established 20 direct studies
Benefit shown to produce clinically meaningful weight loss
Evidence Level
High
15 Human
8 Animal
3 In Vitro
Mechanism Reduction of systemic inflammation and metabolic improvement
Established 15 direct studies
Benefit shown to reduce major adverse cardiovascular events in obesity
Evidence Level
High
2 Human
5 Animal
2 In Vitro
Mechanism Renal hemodynamic effects and natriuresis
Supported 8 direct studies
Benefit shown to slow kidney disease progression in T2D with CKD
Evidence Level
High
1 Human
4 Animal
2 In Vitro
Mechanism Hepatic fat reduction and metabolic improvement
Established 6 direct studies
Benefit shown to resolve MASH and improve liver fibrosis
Evidence Level
High
2 Human
3 Animal
2 In Vitro
Mechanism Confidence
Established
Supported
Emerging
Evidence Level
High
Moderate
Low
Very Low

What to Expect

Timeline based on observations from published studies. Individual responses may vary.

Initial titration period. Studies show GI side effects (nausea 30-45%) are most common during dose escalation. Early appetite reduction begins. HbA1c improvements start becoming measurable. Weight loss typically 2-4% by week 4.

Week 4-12 PMID:33567185

Continued dose escalation toward maintenance dose. GI tolerability typically improves as body adapts. Weight loss accelerates to 5-8%. Blood glucose improvements become more pronounced.

Week 12-28 PMID:33567185

Approaching full therapeutic effect. STEP 1 showed approximately 10-12% weight loss by week 20. HbA1c reductions of 1.0-1.5% typical in diabetes trials. Blood pressure begins to improve.

Week 28-52 PMID:33567185

Near-maximum weight loss achieved. STEP 1 showed 14.9% mean weight loss at 68 weeks. Cardiovascular markers improve. MASH patients show liver enzyme improvements.

Weight loss typically plateaus and is maintained with continued use. STEP 5 showed maintenance at 2 years. Discontinuation results in weight regain (~2/3 of lost weight within 1 year per STEP 4).

Research-Based Observations

This timeline reflects observations from published clinical and preclinical studies. Individual responses may vary significantly. This is not a guarantee of effects or a dosing schedule. Consult qualified healthcare providers for personalized guidance.

Quality Checklist

Visual indicators to help evaluate Semaglutide product quality

Good Signs (6 indicators)
Obtained through licensed pharmacy or authorized healthcare provider
Brand name product (Ozempic, Wegovy, Rybelsus) with intact packaging
Clear, colorless solution in pre-filled pen (injectable forms)
Proper refrigeration before first use (36-46F / 2-8C)
Expiration date clearly visible and not passed
Manufacturer lot number traceable
Warning Signs (5 indicators)
Compounded product (quality may vary by pharmacy)
Product requires reconstitution (legitimate products are pre-filled)
Significantly lower cost than market rate
Shipped without cold pack or temperature indicator
Unclear source or chain of custody
Bad Signs (7 indicators)
Visible particles, cloudiness, or discoloration in solution
Packaging appears tampered with or resealed
No prescription required for purchase
Product labeled from country not authorized for distribution
Missing or illegible lot numbers/expiration dates
Pen mechanism damaged or non-functional
Unusual smell or appearance
Positive quality indicator
Requires evaluation
Potential quality issue

For Research Evaluation Only

These quality indicators are general guidelines based on typical peptide characteristics. Professional laboratory testing (HPLC, mass spectrometry) provides definitive quality verification. This checklist is for initial visual evaluation only.

Peptide Interactions

Known and theoretical interactions when combining Semaglutide with other peptides. Based on published research and mechanistic considerations.

Synergistic
Compatible
Caution
Avoid

Both affect metabolic parameters. Tesamorelin increases GH which may affect glucose homeostasis. Monitor blood glucose closely if considering combination in diabetic patients.

Both affect GI function. BPC-157 is gastroprotective while semaglutide delays gastric emptying. Theoretical interaction unclear; monitor GI symptoms.

GH secretagogues may affect glucose metabolism. Semaglutide treats diabetes while GH can be diabetogenic. Monitor glucose parameters if combined.

MK-677 increases GH and IGF-1, which can impair glucose tolerance. May counteract semaglutide's glycemic benefits. Monitor blood glucose closely.

Do not combine. Both are incretin-based therapies acting on overlapping pathways. Concurrent use would provide redundant GLP-1 agonism with increased risk of severe GI adverse events and hypoglycemia without proven additional benefit.

Do not combine. Both are GLP-1 receptor agonists with identical mechanism of action. No clinical rationale for combination; would increase adverse event risk.

Research Note: Interaction data is based on published literature, mechanistic understanding, and theoretical considerations. Most peptide combinations lack direct clinical study. This information is for educational purposes only and does not constitute medical advice. Always consult qualified healthcare providers.

References

Methodology Note

This dossier synthesizes available evidence from peer-reviewed literature, regulatory documents, and clinical trial registries. Evidence strength ratings follow a modified GRADE approach.

For complete methodology details, see our Methodology page.

Important Disclaimer

This dossier is for educational purposes only and does not constitute medical advice. Always consult a qualified healthcare provider before making health decisions.

Get Research Alerts

New dossiers and major study summaries delivered to your inbox. Evidence-graded, citation-backed research you can trust.

No spam. Unsubscribe anytime.

Compare Semaglutide

Related Peptides

Metabolic

5-Amino-1MQ

5-Amino-1-Methylquinolinium, NNMT Inhibitor

A small molecule NNMT inhibitor studied for metabolic effects in animal models. No human clinical trials have been conducted. Increases NAD+ levels in adipose tissue in preclinical studies.

#metabolic
Metabolic

Amycretin

NNC0487-0111, Oral Amycretin, Subcutaneous Amycretin

A novel single-molecule dual GLP-1/amylin receptor agonist developed by Novo Nordisk. Unlike CagriSema (a fixed-dose combination), amycretin is a unified peptide that activates both pathways. Phase 1 trials showed superior weight loss signals versus semaglutide, with both oral and subcutaneous formulations in development.

#metabolic
Metabolic

AOD-9604

Anti-Obesity Drug 9604, Tyr-hGH Fragment 177-191, hGH Fragment 176-191

A modified fragment of human growth hormone (amino acids 176-191 with N-terminal tyrosine) studied for fat loss. Clinical development discontinued after Phase 2b/3 trials failed to show efficacy in 536 subjects. Now prohibited by WADA and excluded from FDA compounding.

#metabolic
Metabolic

Cagrilintide

AM833, NN9838, ZP8396

A long-acting amylin analog developed by Novo Nordisk for weight management. Currently in Phase 3 trials as CagriSema (combination with semaglutide). Phase 2 data shows up to 22-25% weight loss when combined with semaglutide, potentially exceeding tirzepatide efficacy.

#metabolic
Metabolic

CagriSema

Cagrilintide-Semaglutide, NNC0174-0833

A fixed-dose combination of cagrilintide (amylin analog) and semaglutide (GLP-1 agonist) for chronic weight management. Phase 3 REDEFINE trials demonstrate 20-23% weight loss at 68 weeks. NDA submitted to FDA December 2025. First GLP-1/amylin combination therapy.

#metabolic
Metabolic

CT-388

RG-6912

A dual GLP-1/GIP receptor agonist acquired by Roche through the $2.7 billion Carmot Therapeutics acquisition in 2024. Phase 1b results showed 18.8% placebo-adjusted weight loss at 24 weeks, positioning it as a competitive obesity therapeutic with a mechanism similar to tirzepatide.

#metabolic

Related Content