Now reading Entry 075 / 102 Last revised Apr 13, 2026 95 sources 2 comparisons Methodology →
A specimen of the Metabolic drawer Drawer A · Metabolic

Semaglutide

FDA Approved

A GLP-1 receptor agonist FDA-approved for type 2 diabetes, obesity, cardiovascular risk reduction, and MASH. Among the most extensively studied peptides with robust Phase 3 data demonstrating significant metabolic, cardiovascular, renal, and hepatic benefits.

Ozempic · Wegovy · Rybelsus · NN9535

Research evidence
High

78 human studies

Preclinical
18%
Clinical
82%

Based on 95 cited sources

Evidence Score98/100
Well-evidenced
Research Depth100/100
Mechanism100/100
Plausibility98/100
Global Coverage100/100
Community Experience92/100
Effectiveness91/100

clinically demonstrated · high confidence

Demonstrated effect magnitude — not a recommendation or safety claim.

Research Depth 100: meta-analyses of multiple large low-RoB Phase 3 RCTs (SUSTAIN 27633186, STEP 33567185, SELECT 37952131 N=17,604) with total human N far exceeding 1,000 and direct population/route/outcome match. Mechanism 100: GLP-1R binding plus functional and knockout/antagonist confirmation, full target-to-effect pathway, in-vivo dose-response (STEP UP 40961952). Plausibility 98: full mechanism->surrogate->clinical chain proven across metabolic, CV (37952131/40162642), renal (38785209) and hepatic (40305708) outcomes, with class analogues; minor deduction for multi-system breadth. Global Coverage 100: reproduced across many independent groups/40+ countries, >100 studies, multi-regulator approval. Community Experience 92: large multi-year population-level use, highly consistent reports, but recurring GI and a documented AKI signal cap 5D. Effectiveness basis clinical (high): STEP 1 14.9% vs 2.4% placebo, far exceeds the ~5% MCID, hard patient-relevant outcomes, top-tier vs active comparators though edged head-to-head by tirzepatide.

Scored May 2026 How we rate →
Evidence Level
high
Not approved for human use by any regulatory agency
Limited human clinical trial data
Consult a healthcare provider before use
Not FDA Approved WADA Prohibited
Identity
SCALE · 1:1 N-TERMINUS C-TERMINUS 31 AA · 4,113.58 Da
Also Known As
Ozempic • Wegovy • Rybelsus • NN9535
Class
Modified GLP-1 Analog
Length
31 amino acids
Mol. weight
4,113.58 Da
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Molecular Structure
H
Aib
E
G
T
F
T
S
D
V
S
S
Y
L
E
G
Q
A
A
K
E
F
I
A
W
L
V
K
G
R
K*
Hydrophobic
Polar
Positive
Negative

Semaglutide is a selective GLP-1 receptor agonist with extensive Phase 3 clinical trial data supporting its mechanisms in humans.

How It Works (Simplified)

Semaglutide mimics GLP-1, a natural hormone released after eating, producing multiple therapeutic effects:

Binds to GLP-1 receptors on pancreatic beta cells, triggering glucose-dependent insulin release. Only works when blood sugar is elevated, minimizing hypoglycemia risk.

Acts on hypothalamic hunger centers, activating satiety pathways (POMC/CART) while suppressing hunger signals (NPY/AgRP). Reduces caloric intake by 20-35%.

Glucose Regulation

Suppresses inappropriate glucagon secretion from alpha cells and enhances insulin sensitivity, improving overall glycemic control in type 2 diabetes.

Slows stomach emptying, prolonging satiety after meals and reducing postprandial glucose spikes. Contributes to both weight loss and glycemic benefits.

Key Research: SUSTAIN and STEP Phase 3 programs demonstrated these mechanisms translate to clinically meaningful outcomes in over 20,000 patients. PMID:33567185

2025-2026 Developments

Oral Wegovy Approval: The FDA approved oral semaglutide 25mg (Wegovy) in December 2025, marking the first oral GLP-1 formulation approved for chronic weight management at a launch price of approximately $149/month.

MASH Indication: Semaglutide received FDA approval for metabolic dysfunction-associated steatohepatitis (MASH), expanding its therapeutic indications beyond diabetes and obesity.

Safety Signal — Acute Kidney Injury: A 2025 disproportionality analysis of the FDA Adverse Event Reporting System (FAERS) found that semaglutide carried a reporting signal for acute kidney injury, typically attributed to dehydration from GI adverse events; the authors recommend ensuring hydration and renal monitoring when initiating therapy (PMID: 41227073).

Patent Landscape: The core semaglutide compound patent expired in March 2026 across several major markets including India, Canada, China, Brazil, and Turkey, with 40+ biosimilar applications filed in India alone.

Important Limitations

  • Common GI side effects: Nausea (30-45%), vomiting, diarrhea, and constipation, especially during dose titration
  • Boxed warning: Thyroid C-cell tumors observed in rodents; contraindicated in personal/family history of medullary thyroid carcinoma (MTC) or MEN2
  • Gallbladder disease: Increased risk (~2.5%) associated with rapid weight loss
  • Pancreatitis: Rare (~0.3%) but requires discontinuation if suspected
  • Pregnancy: Contraindicated; discontinue at least 2 months before planned conception
  • Weight regain: Approximately 2/3 of lost weight returns within 1 year of discontinuation (STEP 4)
  • Muscle mass: ~30% of weight lost is lean mass; resistance training recommended
i. GLP-1R Signaling Cascade · Primary Mechanism
SemaglutideGLP-1R (Class B1 GPCR)Gαs activationAdenylyl cyclasecAMP ↑PKA activation
β-cellsGlucose-dependent insulin secretion
α-cellsGlucagon suppression
HypothalamusPOMC/CART ↑, NPY/AgRP ↓ (appetite suppression)
GI tractDelayed gastric emptying
Mechanism GLP-1R activation triggering glucose-dependent insulin secretion
Established 50 direct studies
Benefit shown to significantly reduce HbA1c in type 2 diabetes
Evidence Level
High
25 Human
10 Animal
5 In Vitro
Mechanism Central appetite suppression via hypothalamic POMC/CART activation
Established 20 direct studies
Benefit shown to produce clinically meaningful weight loss
Evidence Level
High
15 Human
8 Animal
3 In Vitro
Mechanism Reduction of systemic inflammation and metabolic improvement
Established 15 direct studies
Benefit shown to reduce major adverse cardiovascular events in obesity
Evidence Level
High
2 Human
5 Animal
2 In Vitro
Mechanism Renal hemodynamic effects and natriuresis
Supported 8 direct studies
Benefit shown to slow kidney disease progression in T2D with CKD
Evidence Level
High
1 Human
4 Animal
2 In Vitro
Mechanism Hepatic fat reduction and metabolic improvement
Established 6 direct studies
Benefit shown to resolve MASH and improve liver fibrosis
Evidence Level
High
2 Human
3 Animal
2 In Vitro
Mechanism Confidence
Established
Supported
Emerging
Evidence Level
High
Moderate
Low
Very Low

Reported positives

  • Significant appetite suppression reported within first week
  • Reduced food noise and cravings consistently cited
  • Improved relationship with food and reduced binge eating
  • Cardiovascular improvements noted by users with comorbidities

Reported negatives

  • Nausea and GI distress common during dose escalation
  • Muscle loss reported without resistance training
  • Fatigue and low energy during initial weeks
  • Hair thinning reported by some users during rapid weight loss

“Most discussed peptide online. r/semaglutide has 200K+ members. Extensive patient community feedback.”

Self-reported, unverified accounts — not clinical evidence and no substitute for the cited research. Anecdotes are prone to selection bias and placebo effects.

NCT ID Title Peptide Phase Status Completion
NCT02128932
SUSTAIN-6: Cardiovascular Outcomes Trial
Semaglutide Phase 3 Completed Jan 2016
NCT03548935
STEP 1: Weight Management in Obesity
Semaglutide Phase 3 Completed Jan 2020
NCT03552757
SELECT: CV Outcomes in Obesity without Diabetes
Semaglutide Phase 3 Completed Jan 2023
NCT04777396
FLOW: Kidney Outcomes in T2D with CKD
Semaglutide Phase 3 Completed Jan 2024
NCT04777409
EVOKE: Semaglutide in Early Alzheimer's Disease
Semaglutide Phase 3 Recruiting -
NCT06977438
Promoting Healthy Children and Youth
Obesity, Childhood
Semaglutide Phase 4 Not yet recruiting Jan 2031
NCT07027969
Metabolic Surgery for Atrial Fibrillation Elimination
Atrial Fibrillation, Obesity and Obesity-related Medical Conditions
Semaglutide Phase 4 Not yet recruiting Dec 2029
NCT07389941
Semaglutide PrIor to CathEeter Ablation in Patients With Atrial Fibrillation
Atrial Fibrillation (AF)
Semaglutide Phase 4 Not yet recruiting Apr 2029
NCT07462663
SHAPE-ENDO: Multimodal Pre-Surgical Optimization in Patients With Obesity and Early-Stage Endometrial Cancer (Phase 1)
Endometrial Cancer, Endometrial Cancer Stage I +7 more
Semaglutide Phase 4 Not yet recruiting May 2027
NCT07282613
A Research Study to See How Much CagriSema Lowers Blood Sugar and Body Weight Compared to Placebo in Children and Adolescents With Type 2 Diabetes
Diabetes Mellitus, Type 2
Semaglutide Phase 3 Not yet recruiting Sep 2029
NCT07357766
A Research Study to Compare Different Versions of Injectable CagriSema and Placebo in People With Excess Body Weight
Overweight, Obesity
Semaglutide Phase 3 Not yet recruiting Nov 2027
NCT06934655
Early Re-Initiation of Semaglutide Post Sleeve Gastrectomy in Youth
Pediatric Obesity, Metabolic and Bariatric Surgery +1 more
Semaglutide Phase 3 Not yet recruiting Nov 2030
NCT07564414
A Research Study to Look at How Two Different Doses of CagriSema and One Dose of Semaglutide Help People Living With Obesity With or Without Type 2 Diabetes Lose Weight
Obesity, Type 2 Diabetes
Semaglutide Phase 3 Recruiting Feb 2028
NCT07021937
Brain Plasticity and GLP-1 Receptor Agonist Treatment for Obesity
Obesity/Therapy
Semaglutide Phase 3 Not yet recruiting Apr 2031
NCT07554417
Combatting Muscle Loss in Obese Adult Patients on GLP-1 Medications Through Dietary Counseling and Exercise During Treatment Evaluates Whether a 12-week Exercise and Individualized Nutrition Program Can Reduce Muscle and Bone Loss and Improve Strength, Fitness, and Function in Obese Adults on GLP-1
GLP - 1, Obesity & Overweight +3 more
Semaglutide Phase 4 Not yet recruiting Jun 2026
NCT06975111
Focusing on the Menopausal Transition to Improve Mid-Life Women's Health
Menopause, Menopause Hot Flashes +2 more
Semaglutide Phase 2/3 Recruiting Oct 2029
NCT07059377
Semaglutide for Smoking Cessation in Patients With Diabetes
Diabetes Mellitus, Type 2, Nicotine Addiction +1 more
Semaglutide Phase 3 Recruiting Jul 2026
NCT02128932 Completed

SUSTAIN-6: Cardiovascular Outcomes Trial

Semaglutide Phase 3 Est. Jan 2016
NCT03548935 Completed

STEP 1: Weight Management in Obesity

Semaglutide Phase 3 Est. Jan 2020
NCT03552757 Completed

SELECT: CV Outcomes in Obesity without Diabetes

Semaglutide Phase 3 Est. Jan 2023
NCT04777396 Completed

FLOW: Kidney Outcomes in T2D with CKD

Semaglutide Phase 3 Est. Jan 2024
NCT04777409 Recruiting

EVOKE: Semaglutide in Early Alzheimer's Disease

Semaglutide Phase 3 Est. -
NCT06977438 Not yet recruiting

Promoting Healthy Children and Youth

Semaglutide Phase 4 Est. Jan 2031
NCT07027969 Not yet recruiting

Metabolic Surgery for Atrial Fibrillation Elimination

Semaglutide Phase 4 Est. Dec 2029
NCT07389941 Not yet recruiting

Semaglutide PrIor to CathEeter Ablation in Patients With Atrial Fibrillation

Semaglutide Phase 4 Est. Apr 2029
NCT07462663 Not yet recruiting

SHAPE-ENDO: Multimodal Pre-Surgical Optimization in Patients With Obesity and Early-Stage Endometrial Cancer (Phase 1)

Semaglutide Phase 4 Est. May 2027
NCT07282613 Not yet recruiting

A Research Study to See How Much CagriSema Lowers Blood Sugar and Body Weight Compared to Placebo in Children and Adolescents With Type 2 Diabetes

Semaglutide Phase 3 Est. Sep 2029
NCT07357766 Not yet recruiting

A Research Study to Compare Different Versions of Injectable CagriSema and Placebo in People With Excess Body Weight

Semaglutide Phase 3 Est. Nov 2027
NCT06934655 Not yet recruiting

Early Re-Initiation of Semaglutide Post Sleeve Gastrectomy in Youth

Semaglutide Phase 3 Est. Nov 2030
NCT07564414 Recruiting

A Research Study to Look at How Two Different Doses of CagriSema and One Dose of Semaglutide Help People Living With Obesity With or Without Type 2 Diabetes Lose Weight

Semaglutide Phase 3 Est. Feb 2028
NCT07021937 Not yet recruiting

Brain Plasticity and GLP-1 Receptor Agonist Treatment for Obesity

Semaglutide Phase 3 Est. Apr 2031
NCT07554417 Not yet recruiting

Combatting Muscle Loss in Obese Adult Patients on GLP-1 Medications Through Dietary Counseling and Exercise During Treatment Evaluates Whether a 12-week Exercise and Individualized Nutrition Program Can Reduce Muscle and Bone Loss and Improve Strength, Fitness, and Function in Obese Adults on GLP-1

Semaglutide Phase 4 Est. Jun 2026
NCT06975111 Recruiting

Focusing on the Menopausal Transition to Improve Mid-Life Women's Health

Semaglutide Phase 2/3 Est. Oct 2029
NCT07059377 Recruiting

Semaglutide for Smoking Cessation in Patients With Diabetes

Semaglutide Phase 3 Est. Jul 2026
Phase 01 1
Week 1-4

Initial titration period. Studies show GI side effects (nausea 30-45%) are most common during dose escalation. Early appetite reduction begins. HbA1c improvements start becoming measurable. Weight loss typically 2-4% by week 4.

PMID:33567185
Phase 02 2
Week 4-12

Continued dose escalation toward maintenance dose. GI tolerability typically improves as body adapts. Weight loss accelerates to 5-8%. Blood glucose improvements become more pronounced.

PMID:33567185
Phase 03 3
Week 12-28

Approaching full therapeutic effect. STEP 1 showed approximately 10-12% weight loss by week 20. HbA1c reductions of 1.0-1.5% typical in diabetes trials. Blood pressure begins to improve.

PMID:33567185
Phase 04 4
Week 28-52

Near-maximum weight loss achieved. STEP 1 showed 14.9% mean weight loss at 68 weeks. Cardiovascular markers improve. MASH patients show liver enzyme improvements.

PMID:33567185
Phase 05 5
Week 52+

Weight loss typically plateaus and is maintained with continued use. STEP 5 showed maintenance at 2 years. Discontinuation results in weight regain (~2/3 of lost weight within 1 year per STEP 4).

PMID:33755728

Research-based observations

This timeline reflects observations from published clinical and preclinical studies. Individual responses may vary significantly. This is not a guarantee of effects or a dosing schedule. Consult qualified healthcare providers for personalized guidance.

Good Signs (6 indicators)
Obtained through licensed pharmacy or authorized healthcare provider
Brand name product (Ozempic, Wegovy, Rybelsus) with intact packaging
Clear, colorless solution in pre-filled pen (injectable forms)
Proper refrigeration before first use (36-46F / 2-8C)
Expiration date clearly visible and not passed
Manufacturer lot number traceable
Warning Signs (5 indicators)
Compounded product (quality may vary by pharmacy)
Product requires reconstitution (legitimate products are pre-filled)
Significantly lower cost than market rate
Shipped without cold pack or temperature indicator
Unclear source or chain of custody
Bad Signs (7 indicators)
Visible particles, cloudiness, or discoloration in solution
Packaging appears tampered with or resealed
No prescription required for purchase
Product labeled from country not authorized for distribution
Missing or illegible lot numbers/expiration dates
Pen mechanism damaged or non-functional
Unusual smell or appearance
Positive quality indicator
Requires evaluation
Potential quality issue

For Research Evaluation Only

These quality indicators are general guidelines based on typical peptide characteristics. Professional laboratory testing (HPLC, mass spectrometry) provides definitive quality verification. This checklist is for initial visual evaluation only.

Synergistic
Compatible
Caution
Avoid

Both affect metabolic parameters. Tesamorelin increases GH which may affect glucose homeostasis. Monitor blood glucose closely if considering combination in diabetic patients.

Both affect GI function. BPC-157 is gastroprotective while semaglutide delays gastric emptying. Theoretical interaction unclear; monitor GI symptoms.

GH secretagogues may affect glucose metabolism. Semaglutide treats diabetes while GH can be diabetogenic. Monitor glucose parameters if combined.

MK-677 increases GH and IGF-1, which can impair glucose tolerance. May counteract semaglutide's glycemic benefits. Monitor blood glucose closely.

Do not combine. Both are incretin-based therapies acting on overlapping pathways. Concurrent use would provide redundant GLP-1 agonism with increased risk of severe GI adverse events and hypoglycemia without proven additional benefit.

Do not combine. Both are GLP-1 receptor agonists with identical mechanism of action. No clinical rationale for combination; would increase adverse event risk.

Research Note: Interaction data is based on published literature, mechanistic understanding, and theoretical considerations. Most peptide combinations lack direct clinical study. This information is for educational purposes only and does not constitute medical advice. Always consult qualified healthcare providers.

This dossier synthesizes available evidence from peer-reviewed literature, regulatory documents, and clinical trial registries. Evidence strength ratings follow a modified GRADE approach.

For complete methodology details, see our Methodology page.

Important Disclaimer

This dossier is for educational purposes only and does not constitute medical advice. Always consult a qualified healthcare provider before making health decisions.

Get Research Alerts

New dossiers and major study summaries delivered to your inbox. Evidence-graded, citation-backed research you can trust.

No spam. Unsubscribe anytime.

Compare Semaglutide

Related Peptides

Metabolic

5-Amino-1MQ

5-Amino-1-Methylquinolinium · NNMT Inhibitor

A small molecule NNMT inhibitor studied for metabolic effects in animal models. No human clinical trials have been conducted. Increases NAD+ levels in adipose tissue in preclinical studies.

See dossier
Metabolic

Amycretin

NNC0487-0111 · Oral Amycretin · Subcutaneous Amycretin

A novel single-molecule dual GLP-1/amylin receptor agonist developed by Novo Nordisk. Unlike CagriSema (a fixed-dose combination), amycretin is a unified peptide that activates both pathways. Phase 1 trials showed superior weight loss signals versus semaglutide, with both oral and subcutaneous formulations in development.

See dossier
Metabolic

AOD-9604

Anti-Obesity Drug 9604 · Tyr-hGH Fragment 177-191 · hGH Fragment 176-191

A modified fragment of human growth hormone (amino acids 176-191 with N-terminal tyrosine) studied for fat loss. Clinical development discontinued after Phase 2b/3 trials failed to show efficacy in 536 subjects. Now prohibited by WADA and excluded from FDA compounding.

See dossier
Metabolic

Cagrilintide

AM833 · NN9838

A long-acting amylin analog developed by Novo Nordisk for weight management. Studied in Phase 3 trials as CagriSema (combination with semaglutide). The Phase 3 REDEFINE 1 trial showed -20.4% weight loss with cagrilintide-semaglutide versus -3.0% with placebo at 68 weeks.

See dossier
Metabolic

CagriSema

Cagrilintide-Semaglutide · NNC0174-0833

A fixed-dose combination of cagrilintide (amylin analog) and semaglutide (GLP-1 agonist) for chronic weight management. Phase 3 REDEFINE trials demonstrate 20-23% weight loss at 68 weeks. NDA submitted to FDA December 2025. First GLP-1/amylin combination therapy.

See dossier
Metabolic

CT-388

RG-6912

A dual GLP-1/GIP receptor agonist (INN enicepatide; also RO7795068) acquired by Roche through the $2.7 billion Carmot Therapeutics acquisition in 2024. The published Phase 1 trial (NCT04838405) showed 4.7-8.0% mean weight loss vs 0.5% placebo over 4 weeks; a more widely reported ~18.8% placebo-adjusted figure at 24 weeks comes from an unpublished Phase 1 extension reported via press release. Phase 2 obesity and T2D trials are completed or ongoing and Phase 3 began in 2026, positioning it as a competitive obesity therapeutic with a mechanism similar to tirzepatide.

See dossier

Related Content